PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 277aa    MW: 31602.4 Da    PI: 4.393
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58684400PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.3e-2165118356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++++eq++ Le+ Fe+++++  e+++eLAkklgL+ rqV vWFqNrRa++k
  Lsa002486  65 KKRRLSPEQVHMLEQSFEEDNKLEPERKTELAKKLGLQPRQVAVWFQNRRARWK 118
                56689************************************************9 PP

2HD-ZIP_I/II134.63.5e-4364155192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrls eqv++LE+sFee++kLeperK+ela++LglqprqvavWFqnrRAR+ktk lE+dy++Lk++yd l+++ +++ ke+e+L++e+ 
    Lsa002486  64 EKKRRLSPEQVHMLEQSFEEDNKLEPERKTELAKKLGLQPRQVAVWFQNRRARWKTKTLERDYDRLKSSYDILTSDFDSIAKENEKLKAEVV 155
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-2056120IPR009057Homeodomain-like
PROSITE profilePS5007118.28560120IPR001356Homeobox domain
SMARTSM003898.0E-2163124IPR001356Homeobox domain
CDDcd000865.89E-2065120No hitNo description
PfamPF000464.9E-1865118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.3E-2266127IPR009057Homeodomain-like
PRINTSPR000311.4E-691100IPR000047Helix-turn-helix motif
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PRINTSPR000311.4E-6100116IPR000047Helix-turn-helix motif
PfamPF021834.7E-17120162IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MESGRLFFGC NSSNMLFLGN GNGDNYFRGT RMGFNMEESS KKRPFLSSID DMLEEEYYDE  60
QLTEKKRRLS PEQVHMLEQS FEEDNKLEPE RKTELAKKLG LQPRQVAVWF QNRRARWKTK  120
TLERDYDRLK SSYDILTSDF DSIAKENEKL KAEVVSLTEK LQSKEAANIS RTGEDADTAA  180
EEAGHIPPPS ATVKIEDHLS TGSGGSAVVD DLDGPQLVDS GDSYFPADAD YPHEYAAPVD  240
QSEEDDGSDD GRNNFSYQFD HHHHHEEDDS LGWWVWS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007031433.11e-114Homeobox-leucine zipper protein HAT5
SwissprotQ022831e-85HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A103XL351e-131A0A103XL35_CYNCS; Helix-turn-helix motif-containing protein
STRINGVIT_14s0066g01440.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-79homeobox 1